Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GUCY1B1 Rabbit Polyclonal Antibody (Biotin)

GUCY1B1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1

UniProt

Q02153

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_000848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btnl4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6137402 1.0 µg DNA

Btnl4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone:2F5]
E45M17087 100 µg

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone:2F5]

Sign In for Pricing
View Details
Palldl1 Rat siRNA Oligo Duplex (Locus ID 364558)
SR507196 1 Kit

Palldl1 Rat siRNA Oligo Duplex (Locus ID 364558)

Sign In for Pricing
View Details
Genorise® Human CRP Expression Plasmid, 10 ug
GR163011 10 µg

Genorise® Human CRP Expression Plasmid, 10 ug

Sign In for Pricing
View Details
Collagen IV Rabbit pAb, BF700 conjugated
orb2876253 100 µL

Collagen IV Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal ZNF230 Antibody (OTI1E2) [HRP]
NBP2-74934H 0.1 mL

Mouse Monoclonal ZNF230 Antibody (OTI1E2) [HRP]

Sign In for Pricing
View Details