Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GUCY1B1 Rabbit Polyclonal Antibody (HRP)

GUCY1B1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1

UniProt

Q02153

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GUCY1B3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Vicia faba Lectin (Fava Bean) -VFA-
T-4801-1 1 mg

Texas Red Conjugated Vicia faba Lectin (Fava Bean) -VFA-

Sign In for Pricing
View Details
Biotin Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189B-01 25 µg

Biotin Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Biotin Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189B-02 100 µg

Biotin Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
5-OG488 acid [equivalent to Oregon Green® 488 carboxylic acid, 5-isomer]
708-AAT 25 mg

5-OG488 acid [equivalent to Oregon Green® 488 carboxylic acid, 5-isomer]

Sign In for Pricing
View Details
Telomerase reverse transcriptase (TERT) Human Gene Knockout Kit (CRISPR)
KN217436BN 1 Kit

Telomerase reverse transcriptase (TERT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C3orf22 Human qPCR Primer Pair (NM_152533)
HP217783 200 Reactions

C3orf22 Human qPCR Primer Pair (NM_152533)

Sign In for Pricing
View Details