Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM1 Rabbit Polyclonal Antibody (HRP)

RRM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R1, RR1, RIR1

UniProt

P23921

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RRM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP19 Rabbit Polyclonal Antibody
orb631507-01 50 µg

SRP19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SRP19 Rabbit Polyclonal Antibody
orb631507-02 100 µg

SRP19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Grant 38L stainless steel Optima tank
BAT3910 1 Each

Grant 38L stainless steel Optima tank

Sign In for Pricing
View Details
Cyclin D3 (G277) polyclonal antibody
orb642822-01 25 µL

Cyclin D3 (G277) polyclonal antibody

Sign In for Pricing
View Details
Cyclin D3 (G277) polyclonal antibody
orb642822-02 50 μL

Cyclin D3 (G277) polyclonal antibody

Sign In for Pricing
View Details
Cyclin D3 (G277) polyclonal antibody
orb642822-03 100 µL

Cyclin D3 (G277) polyclonal antibody

Sign In for Pricing
View Details