Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM1 Rabbit Polyclonal Antibody (Biotin)

RRM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

R1, RR1, RIR1

UniProt

P23921

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RRM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7249698-01 48 Well

Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Sign In for Pricing
View Details
Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7249698-02 96 Well

Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Sign In for Pricing
View Details
Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7249698-03 5x 96 Well

Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Sign In for Pricing
View Details
Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit
MBS7249698-04 10x 96 Well

Mouse Acyl-coenzyme A synthetase ACSM4, mitochondrial (ACSM4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Ashbya gossypii J protein JJJ2 (JJJ2), partial
MBS1287714 Inquire

Recombinant Ashbya gossypii J protein JJJ2 (JJJ2), partial

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Neuronal Apoptosis Inhibitory Protein (NAIP)
MBS2056179-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Neuronal Apoptosis Inhibitory Protein (NAIP)

Sign In for Pricing
View Details