Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM1 Rabbit Polyclonal Antibody (FITC)

RRM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

R1, RR1, RIR1

UniProt

P23921

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RRM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Whatman No. 113 90mm Filter Paper circles
FIL2121 100 / PCK

Whatman No. 113 90mm Filter Paper circles

Sign In for Pricing
View Details
LDLR Polyclonal Antibody
UB-GEN-6947 100 µL

LDLR Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD40 antibody, mouse monoclonal (5C3), FITC-labeled, IF, FACS, IHC, Azide & carrier free
72-032 Inquire

Anti-CD40 antibody, mouse monoclonal (5C3), FITC-labeled, IF, FACS, IHC, Azide & carrier free

Sign In for Pricing
View Details
Human BSDC1 Protein Lysate
MBS138093-01 0.02 mg

Human BSDC1 Protein Lysate

Sign In for Pricing
View Details
Human BSDC1 Protein Lysate
MBS138093-02 5x 0.02 mg

Human BSDC1 Protein Lysate

Sign In for Pricing
View Details
1- (4-Chlorophenyl) -3- (4-methylphenyl) -1H-pyrazole-5-carboxylic acid
FC57113-01 250 mg

1- (4-Chlorophenyl) -3- (4-methylphenyl) -1H-pyrazole-5-carboxylic acid

Sign In for Pricing
View Details