Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM1 Rabbit Polyclonal Antibody (HRP)

RRM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R1, RR1, RIR1

UniProt

P23921

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RRM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5L2 (NM_001004739) Human Tagged ORF Clone
RG211789 10 µg

OR5L2 (NM_001004739) Human Tagged ORF Clone

Sign In for Pricing
View Details
PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (PE)
MBS6493220-01 0.2 mL

PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (PE)

Sign In for Pricing
View Details
PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (PE)
MBS6493220-02 5x 0.2 mL

PI3KC3, Phosphorylated (Ser676) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (PE)

Sign In for Pricing
View Details
(3,5-dimethylisoxazol-4-yl) (piperidino) methanone
OR29395 1 Each

(3,5-dimethylisoxazol-4-yl) (piperidino) methanone

Sign In for Pricing
View Details
Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody [Alexa Fluor 488]
NBP2-04044AF488 0.1 mL

Rabbit Polyclonal Thyroid receptor-interacting protein 13 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
CFAP410 Peptide - N-terminal region
MBS3232896-01 0.1 mg

CFAP410 Peptide - N-terminal region

Sign In for Pricing
View Details