Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2 Rabbit Polyclonal Antibody (FITC)

RRM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

R2, RR2, RR2M, C2orf48

UniProt

P31350

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RRM2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish IDH3B Rabbit Polyclonal Antibody (HRP)
orb2804932 100 µg

Zebrafish IDH3B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MYL4 (MLC1, Myosin Light Chain 4, Myosin Light Chain 1, Embryonic Muscle/Atrial Isoform, Myosin Light Chain Alkali GT-1 Isoform, PRO1957) (MaxLight 490)
MBS6201986-01 0.1 mL

MYL4 (MLC1, Myosin Light Chain 4, Myosin Light Chain 1, Embryonic Muscle/Atrial Isoform, Myosin Light Chain Alkali GT-1 Isoform, PRO1957) (MaxLight 490)

Sign In for Pricing
View Details
MYL4 (MLC1, Myosin Light Chain 4, Myosin Light Chain 1, Embryonic Muscle/Atrial Isoform, Myosin Light Chain Alkali GT-1 Isoform, PRO1957) (MaxLight 490)
MBS6201986-02 5x 0.1 mL

MYL4 (MLC1, Myosin Light Chain 4, Myosin Light Chain 1, Embryonic Muscle/Atrial Isoform, Myosin Light Chain Alkali GT-1 Isoform, PRO1957) (MaxLight 490)

Sign In for Pricing
View Details
Anti-CD3 Antibody [SK7], PerCP-25Tests
QAB4-PCP-25Tests 25Tests

Anti-CD3 Antibody [SK7], PerCP-25Tests

Sign In for Pricing
View Details
Rabbit Polyclonal RAB3B Antibody [Alexa Fluor 750]
NBP2-97202AF750 0.1 mL

Rabbit Polyclonal RAB3B Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Zfp131 (NM_028245) Mouse Tagged ORF Clone Lentiviral Particle
MR222311L4V 200 µL

Zfp131 (NM_028245) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details