Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRM2B Rabbit Polyclonal Antibody (HRP)

RRM2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P53R2, MTDPS8A, MTDPS8B

UniProt

Q7LG56

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RRM2B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-6X His - 70nm Gold Conjugate
AC-70-21-15 1 mL

Anti-6X His - 70nm Gold Conjugate

Sign In for Pricing
View Details
ST3GAL3 Polyclonal Antibody
orb3150189-01 50 µg

ST3GAL3 Polyclonal Antibody

Sign In for Pricing
View Details
ST3GAL3 Polyclonal Antibody
orb3150189-02 100 µg

ST3GAL3 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (APC)
MBS6365690-01 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (APC)

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (APC)
MBS6365690-02 5x 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (APC)

Sign In for Pricing
View Details
TRMT2B, NT (TRMT2B, CXorf34, tRNA (uracil (54) -C (5) ) -methyltransferase homolog, TRM2 homolog) (MaxLight 550) discontinued
043278-ML550 100 µL

TRMT2B, NT (TRMT2B, CXorf34, tRNA (uracil (54) -C (5) ) -methyltransferase homolog, TRM2 homolog) (MaxLight 550) discontinued

Sign In for Pricing
View Details