Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCLAF Rabbit Polyclonal Antibody (HRP)

PCLAF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L5, PAF, OEATC, PAF15, OEATC1, p15PAF, NS5ATP9, OEATC-1, p15/PAF, KIAA0101, p15 (PAF)

UniProt

A6NNU5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA0101

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKEHVLCNLI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

7kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001025160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 7 (C-terminus) Antibody
MBS9215450-01 0.1 mL

Keratin 7 (C-terminus) Antibody

Sign In for Pricing
View Details
Keratin 7 (C-terminus) Antibody
MBS9215450-02 5x 0.1 mL

Keratin 7 (C-terminus) Antibody

Sign In for Pricing
View Details
TCEB1P19 Recombinant Protein (Human)
RP101306 100 µg

TCEB1P19 Recombinant Protein (Human)

Sign In for Pricing
View Details
1- (3-Fluorophenyl) cyclobutane-1-carboxylic acid
EHA41184 5 g

1- (3-Fluorophenyl) cyclobutane-1-carboxylic acid

Sign In for Pricing
View Details
DNAI1 3'UTR Luciferase Stable Cell Line
TU006119 1.0 mL

DNAI1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
UBE2U Rabbit pAb, AE conjugated
orb2879549 100 µL

UBE2U Rabbit pAb, AE conjugated

Sign In for Pricing
View Details