Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFIT3 Rabbit Polyclonal Antibody (HRP)

IFIT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P60, IRG2, IFI60, IFIT4, ISG60, RIG-G, cig41, CIG-49, GARG-49

UniProt

O14879

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IFIT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001026853

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-VEGF receptor 2 (Tyr1059) Polyclonal Antibody, PE-Cy5 Conjugated
bs-3467R-PE-Cy5 100 µL

Phospho-VEGF receptor 2 (Tyr1059) Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
pACYCDuet-1 Plasmid
PVT0102 2 µg

pACYCDuet-1 Plasmid

Sign In for Pricing
View Details
Medium 199 w/ Hanks' Salts w/ L-Glutamine - 500ml
LM-M1901/500 500 mL

Medium 199 w/ Hanks' Salts w/ L-Glutamine - 500ml

Sign In for Pricing
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1224501-01 0.02 mg (E-Coli)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1224501-02 0.1 mg (E-Coli)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details
Recombinant Influenza A virus Non-structural protein 1 (NS)
MBS1224501-03 0.02 mg (Yeast)

Recombinant Influenza A virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details