Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KYNU Rabbit Polyclonal Antibody (HRP)

KYNU Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KYNUU, VCRL2

UniProt

Q16719

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KYNU

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003928

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camk1g, CT (Camk1g, Calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaMK-like CREB kinase III) (AP) discontinued
033159-AP 200 µL

Camk1g, CT (Camk1g, Calcium/calmodulin-dependent protein kinase type 1G, CaM kinase I gamma, CaMK-like CREB kinase III) (AP) discontinued

Sign In for Pricing
View Details
Tert-Butyl 3,3-bis (bromomethyl) azetidine-1-carboxylate
YID13164-01 0.5 g

Tert-Butyl 3,3-bis (bromomethyl) azetidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl 3,3-bis (bromomethyl) azetidine-1-carboxylate
YID13164-02 5 g

Tert-Butyl 3,3-bis (bromomethyl) azetidine-1-carboxylate

Sign In for Pricing
View Details
Test Tube With Socket
2067480/2 1 Each

Test Tube With Socket

Sign In for Pricing
View Details
ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1)
123517 100 µg

ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1)

Sign In for Pricing
View Details
Glu-Glu-tag Rabbit Polyclonal Antibody
orb315831-01 30 µL

Glu-Glu-tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details