Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFD2 Rabbit Polyclonal Antibody (HRP)

MTHFD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NMDMC

UniProt

P13995

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea-pig PPAR-δ (Peroxisome Proliferator Activated Receptor Delta) ValidElisa Kit
EK348133 96 Well

Guinea-pig PPAR-δ (Peroxisome Proliferator Activated Receptor Delta) ValidElisa Kit

Sign In for Pricing
View Details
ATOH1, CT (ATOH1, ATH1, BHLHA14, Protein atonal homolog 1, Class A basic helix-loop-helix protein 14, Helix-loop-helix protein hATH-1) (PE) discontinued
032258-PE 200 µL

ATOH1, CT (ATOH1, ATH1, BHLHA14, Protein atonal homolog 1, Class A basic helix-loop-helix protein 14, Helix-loop-helix protein hATH-1) (PE) discontinued

Sign In for Pricing
View Details
YhdW Antibody
orb829787 2 mg

YhdW Antibody

Sign In for Pricing
View Details
NFkappaB-p100/p52 (Ab-865) Antibody
MBS857665-01 0.05 mg

NFkappaB-p100/p52 (Ab-865) Antibody

Sign In for Pricing
View Details
NFkappaB-p100/p52 (Ab-865) Antibody
MBS857665-02 0.1 mg

NFkappaB-p100/p52 (Ab-865) Antibody

Sign In for Pricing
View Details
NFkappaB-p100/p52 (Ab-865) Antibody
MBS857665-03 0.1 mL (AF750)

NFkappaB-p100/p52 (Ab-865) Antibody

Sign In for Pricing
View Details