Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTH Rabbit Polyclonal Antibody (Biotin)

CTH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC9471

UniProt

P32929

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zmym5 shRNA (UAS) - Lentiviral mouse Zmym5 shRNA (UAS, iRFP) (25)
GTR15277670 1 Vial

Lentiviral mouse Zmym5 shRNA (UAS) - Lentiviral mouse Zmym5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Lumbricus terrestris NADH-ubiquinone oxidoreductase chain 6 (ND6)
orb2920709-01 20 µg

Recombinant Lumbricus terrestris NADH-ubiquinone oxidoreductase chain 6 (ND6)

Sign In for Pricing
View Details
Recombinant Lumbricus terrestris NADH-ubiquinone oxidoreductase chain 6 (ND6)
orb2920709-02 100 µg

Recombinant Lumbricus terrestris NADH-ubiquinone oxidoreductase chain 6 (ND6)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Alkyl hydroperoxide reductase AhpD (ahpD)
MBS1410093-01 0.02 mg (E-Coli)

Recombinant Brucella suis biovar 1 Alkyl hydroperoxide reductase AhpD (ahpD)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Alkyl hydroperoxide reductase AhpD (ahpD)
MBS1410093-02 0.1 mg (E-Coli)

Recombinant Brucella suis biovar 1 Alkyl hydroperoxide reductase AhpD (ahpD)

Sign In for Pricing
View Details
Recombinant Brucella suis biovar 1 Alkyl hydroperoxide reductase AhpD (ahpD)
MBS1410093-03 0.02 mg (Yeast)

Recombinant Brucella suis biovar 1 Alkyl hydroperoxide reductase AhpD (ahpD)

Sign In for Pricing
View Details