Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA4 Rabbit Polyclonal Antibody (FITC)

HSPA4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RY, APG-2, HSPH2, hsp70, hsp70RY, HEL-S-5a, HS24/P52

UniProt

P34932

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPA4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Lgr4 activation kit by CRISPRa
GA212002 1 Kit

Mouse Lgr4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)
MBS1060927-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)
MBS1060927-02 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)
MBS1060927-03 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)
MBS1060927-04 0.1 mg (Yeast)

Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)
MBS1060927-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas aeruginosa UPF0176 protein PSPA7_4661 (PSPA7_4661)

Sign In for Pricing
View Details