Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA4 Rabbit Polyclonal Antibody (HRP)

HSPA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RY, APG-2, HSPH2, hsp70, hsp70RY, HEL-S-5a, HS24/P52

UniProt

P34932

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL3 discontinued
387974 200 µL

CXCL3 discontinued

Sign In for Pricing
View Details
Octapeptide 2, aa137-144 (Prepro-Bombinin-like Peptide)
302101 500 µg

Octapeptide 2, aa137-144 (Prepro-Bombinin-like Peptide)

Sign In for Pricing
View Details
WFDC12 CRISPRa sgRNA lentivector (set of three targets)(Human)
50401121 3x 1.0µg DNA

WFDC12 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ARPIN siRNA (Human)
orb1850733-01 15 nmol

ARPIN siRNA (Human)

Sign In for Pricing
View Details
ARPIN siRNA (Human)
orb1850733-02 30 nmol

ARPIN siRNA (Human)

Sign In for Pricing
View Details
Mouse Anti-Bovine Glucose-regulated Protein 94 (GRP94) Monoclonal Antibody
VD11N191 1 Each

Mouse Anti-Bovine Glucose-regulated Protein 94 (GRP94) Monoclonal Antibody

Sign In for Pricing
View Details