Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MX1 Rabbit Polyclonal Antibody (HRP)

MX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MX, MxA, IFI78, IFI-78K, lncMX1-215

UniProt

P20591

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_002453

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubredoxin Antibody, FITC conjugated
MBS7049937-01 0.05 mg

Rubredoxin Antibody, FITC conjugated

Sign In for Pricing
View Details
Rubredoxin Antibody, FITC conjugated
MBS7049937-02 0.1 mg

Rubredoxin Antibody, FITC conjugated

Sign In for Pricing
View Details
Rubredoxin Antibody, FITC conjugated
MBS7049937-03 5x 0.1 mg

Rubredoxin Antibody, FITC conjugated

Sign In for Pricing
View Details
JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand
orb2692698-01 5 mg

JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand

Sign In for Pricing
View Details
JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand
orb2692698-02 10 mg

JAG - 1 (188 - 204), Jagged - 1 (188 - 204), Notch Ligand

Sign In for Pricing
View Details
FUBP1 Polyclonal Antibody
MBS9132436-01 0.02 mL

FUBP1 Polyclonal Antibody

Sign In for Pricing
View Details