Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB9 Rabbit Polyclonal Antibody (FITC)

PSMB9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LMP2, PRAAS3, PSMB6i, RING12, beta1i

UniProt

P28065

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PSMB9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002791

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV809945 1.0 µg DNA

CHRNA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
ILVBL (Acetolactate synthase-like protein) BioAssayTM ELISA Kit (Human) discontinued
356808-01 48 Tests

ILVBL (Acetolactate synthase-like protein) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
ILVBL (Acetolactate synthase-like protein) BioAssayTM ELISA Kit (Human) discontinued
356808-02 96 Tests

ILVBL (Acetolactate synthase-like protein) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
LYVE1, NT (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, Cell Surface Retention Sequence-binding Protein 1, CRSBP-1, Hyaluronic Acid Receptor, Extracellular Link Domain-containing Protein 1, LYVE-1, CRSBP1, HAR, XLKD1, UNQ230/PRO263) (MaxLight
MBS6485711-01 0.1 mL

LYVE1, NT (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, Cell Surface Retention Sequence-binding Protein 1, CRSBP-1, Hyaluronic Acid Receptor, Extracellular Link Domain-containing Protein 1, LYVE-1, CRSBP1, HAR, XLKD1, UNQ230/PRO263) (MaxLight

Sign In for Pricing
View Details
LYVE1, NT (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, Cell Surface Retention Sequence-binding Protein 1, CRSBP-1, Hyaluronic Acid Receptor, Extracellular Link Domain-containing Protein 1, LYVE-1, CRSBP1, HAR, XLKD1, UNQ230/PRO263) (MaxLight
MBS6485711-02 5x 0.1 mL

LYVE1, NT (Lymphatic Vessel Endothelial Hyaluronic Acid Receptor 1, Cell Surface Retention Sequence-binding Protein 1, CRSBP-1, Hyaluronic Acid Receptor, Extracellular Link Domain-containing Protein 1, LYVE-1, CRSBP1, HAR, XLKD1, UNQ230/PRO263) (MaxLight

Sign In for Pricing
View Details
DAPK1 Antibody
orb2672091-01 50 µL

DAPK1 Antibody

Sign In for Pricing
View Details