Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fscn1 Rabbit Polyclonal Antibody (HRP)

Fscn1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fa, Fan1, fasc, AI663989, fascin-1

UniProt

Q61553

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032010

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1E Polyclonal Antibody
41647-01 50 µL

CD1E Polyclonal Antibody

Sign In for Pricing
View Details
CD1E Polyclonal Antibody
41647-02 100 µL

CD1E Polyclonal Antibody

Sign In for Pricing
View Details
Human anti-CEA antibody ELISA Kit
EH5050 96 Tests

Human anti-CEA antibody ELISA Kit

Sign In for Pricing
View Details
Anti-BBS2 Antibody
A03941 100 µL

Anti-BBS2 Antibody

Sign In for Pricing
View Details
2510009E07Rik Mouse shRNA Plasmid (Locus ID 72190)
TL515745 1 Kit

2510009E07Rik Mouse shRNA Plasmid (Locus ID 72190)

Sign In for Pricing
View Details
Human SERPINE3 activation kit by CRISPRa
GA118802 1 Kit

Human SERPINE3 activation kit by CRISPRa

Sign In for Pricing
View Details