Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAGE1 Rabbit Polyclonal Antibody (FITC)

PAGE1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AL5, CT16.3, GAGE-9, GAGEB1, PAGE-1

UniProt

O75459

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAGE1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF57, NT (ZNF57, ZNF424, Zinc finger protein 57, Zinc finger protein 424) (MaxLight 550)
MBS6367082-01 0.1 mL

ZNF57, NT (ZNF57, ZNF424, Zinc finger protein 57, Zinc finger protein 424) (MaxLight 550)

Sign In for Pricing
View Details
ZNF57, NT (ZNF57, ZNF424, Zinc finger protein 57, Zinc finger protein 424) (MaxLight 550)
MBS6367082-02 5x 0.1 mL

ZNF57, NT (ZNF57, ZNF424, Zinc finger protein 57, Zinc finger protein 424) (MaxLight 550)

Sign In for Pricing
View Details
Mek1 (MAPK/ERK Kinase 1, MEK 1, MEKK1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, Map2k1, MAPKK 1, MAPKK1, Prkmk1, ERK Activator Kinase 1) (HRP)
M2865-15-HRP 100 µL

Mek1 (MAPK/ERK Kinase 1, MEK 1, MEKK1, Dual Specificity Mitogen-activated Protein Kinase Kinase 1, MAP Kinase Kinase 1, Map2k1, MAPKK 1, MAPKK1, Prkmk1, ERK Activator Kinase 1) (HRP)

Sign In for Pricing
View Details
IP-10/CXCL10 (Human) ELISA Kit
E4826-100 96 Assays

IP-10/CXCL10 (Human) ELISA Kit

Sign In for Pricing
View Details
CELLview Petri dish, TC, glass bottom, 35x10mm, 8,7cm2, polystyrene, with vents, subpacked per 10 pieces, STERILE, 40 pieces per CAR
627860 40 pieces per CAR

CELLview Petri dish, TC, glass bottom, 35x10mm, 8,7cm2, polystyrene, with vents, subpacked per 10 pieces, STERILE, 40 pieces per CAR

Sign In for Pricing
View Details
Rat Mammary Ductal Epithelial Cell Medium
ARM0297 500 mL

Rat Mammary Ductal Epithelial Cell Medium

Sign In for Pricing
View Details