Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAGE1 Rabbit Polyclonal Antibody (HRP)

PAGE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AL5, CT16.3, GAGE-9, GAGEB1, PAGE-1

UniProt

O75459

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAGE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Drotaveraldine
TRC-D689670-10MG 10 mg

Drotaveraldine

Sign In for Pricing
View Details
Rat C14h2orf74 Pre-designed siRNA Set B
SI201633B 1 Each

Rat C14h2orf74 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody
MBS9450846-01 0.1 mL (Biotin)

Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody
MBS9450846-02 0.1 mL (AF350)

Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody
MBS9450846-03 0.1 mL (AF405)

Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody
MBS9450846-04 0.1 mL (AF488)

Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details