Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB9A Rabbit Polyclonal Antibody (Biotin)

RAB9A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RAB9

UniProt

P51151

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB9A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-23p40 (Interleukin-23 Subunit p40, IL-23 Subunit p40, Interleukin-12 Subunit beta, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40kD Subunit, CLMF p40, IL-12 Subunit p40, NK Cell Stimulatory Factor Chain 2, NKSF2) discontinued. See I8443-41
044916 50 µg

IL-23p40 (Interleukin-23 Subunit p40, IL-23 Subunit p40, Interleukin-12 Subunit beta, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40kD Subunit, CLMF p40, IL-12 Subunit p40, NK Cell Stimulatory Factor Chain 2, NKSF2) discontinued. See I8443-41

Sign In for Pricing
View Details
PRAMEF10, CT (PRAMEF10, PRAME family member 10) (MaxLight 550) discontinued
040382-ML550 100 µL

PRAMEF10, CT (PRAMEF10, PRAME family member 10) (MaxLight 550) discontinued

Sign In for Pricing
View Details
SNX29 Antibody
orb254312 100 µL

SNX29 Antibody

Sign In for Pricing
View Details
Retifanlimab (Anti-PDCD1 / PD-1 / CD279)
C00759-1mg*25 25x 1mg

Retifanlimab (Anti-PDCD1 / PD-1 / CD279)

Sign In for Pricing
View Details
Human USO1 ELISA kit
orb624237-01 48 Tests

Human USO1 ELISA kit

Sign In for Pricing
View Details
Human USO1 ELISA kit
orb624237-02 96 Tests

Human USO1 ELISA kit

Sign In for Pricing
View Details