Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB9A Rabbit Polyclonal Antibody (Biotin)

RAB9A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RAB9

UniProt

P51151

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB9A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cluster of Differentiation 97 (CD97) Chicken ELISA Kit
C2408 96 Tests

Cluster of Differentiation 97 (CD97) Chicken ELISA Kit

Sign In for Pricing
View Details
ZIC4 (Zic Family Member 4, Zinc Family Member 4 Protein HZIC4, Zinc Finger Protein Of The Cerebellum 4, Zinc Finger Protein ZIC 4) (Azide Free)
Z0737-04 100 µg

ZIC4 (Zic Family Member 4, Zinc Family Member 4 Protein HZIC4, Zinc Finger Protein Of The Cerebellum 4, Zinc Finger Protein ZIC 4) (Azide Free)

Sign In for Pricing
View Details
CD11c Antibody
orb749365-01 20 µg

CD11c Antibody

Sign In for Pricing
View Details
CD11c Antibody
orb749365-02 100 µg

CD11c Antibody

Sign In for Pricing
View Details
SRT3025 HCl
C13441-5mg 5 mg

SRT3025 HCl

Sign In for Pricing
View Details
CDK4, CT (CDK4, Cyclin-dependent kinase 4, Cell division protein kinase 4, PSK-J3) (MaxLight 405) discontinued
033663-ML405 100 µL

CDK4, CT (CDK4, Cyclin-dependent kinase 4, Cell division protein kinase 4, PSK-J3) (MaxLight 405) discontinued

Sign In for Pricing
View Details