Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXA2 Rabbit Polyclonal Antibody (HRP)

FOXA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HNF3B, TCF3B, HNF-3-beta

UniProt

Q9Y261

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_710141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ASPDH shRNA (UAS) - Lentiviral human ASPDH shRNA (UAS, RFP) plasmid
GTR15342412 1 Vial

Lentiviral human ASPDH shRNA (UAS) - Lentiviral human ASPDH shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
HSP90 beta Mouse Monoclonal Antibody (Biotin)
orb452963 100 µL

HSP90 beta Mouse Monoclonal Antibody (Biotin)

Sign In for Pricing
View Details
FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)
246151-ML650 100 µL

FLI1 (Friend Leukemia Virus Integration 1, EWSR2, SIC-1) (MaxLight 650)

Sign In for Pricing
View Details
Acovenoside A
T124440-01 1 mg

Acovenoside A

Sign In for Pricing
View Details
Acovenoside A
T124440-02 5 mg

Acovenoside A

Sign In for Pricing
View Details
Human IGSF8 Pre-designed siRNA Set B
SI007533B 1 Each

Human IGSF8 Pre-designed siRNA Set B

Sign In for Pricing
View Details