Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF133 Rabbit Polyclonal Antibody (FITC)

ZNF133 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF150, pHZ-13, pHZ-66

UniProt

P52736

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZNF133

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GFKSALIRHQRTHSGEKPYVCRECGRGFSQKSHLHRHRRTKSGHQLLPQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001076799.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcineurin A / PPP3CA (BF1.1), CF647 conjugate, 0.1mg/mL
BNC472283-100 1x 100 µL

Calcineurin A / PPP3CA (BF1.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
E-EL-M1033-01 24 Tests

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
E-EL-M1033-02 48 Tests

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit
E-EL-M1033-03 96 Tests

Mouse S100B (S100 Calcium Binding Protein B) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Activin Receptor 2B/ACVR2B Protein (His Tag)
PKSH032040-01 10 µg

Recombinant Human Activin Receptor 2B/ACVR2B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Activin Receptor 2B/ACVR2B Protein (His Tag)
PKSH032040-02 50 µg

Recombinant Human Activin Receptor 2B/ACVR2B Protein (His Tag)

Sign In for Pricing
View Details