Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx1 Rabbit Polyclonal Antibody (FITC)

Prrx1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pmx1, Prx-1

UniProt

P63014

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Prrx1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQVPTVN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_722543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAP2C, CT (Lipid Phosphate Phosphohydrolase 2, Phosphatidic Acid Phosphatase 2c, PAP-2c, PAP2c, Phosphatidate Phosphohydrolase Type 2c, PAP2-gamma, PAP2-G, LPP2) (FITC)
MBS6492982-01 0.2 mL

PPAP2C, CT (Lipid Phosphate Phosphohydrolase 2, Phosphatidic Acid Phosphatase 2c, PAP-2c, PAP2c, Phosphatidate Phosphohydrolase Type 2c, PAP2-gamma, PAP2-G, LPP2) (FITC)

Sign In for Pricing
View Details
PPAP2C, CT (Lipid Phosphate Phosphohydrolase 2, Phosphatidic Acid Phosphatase 2c, PAP-2c, PAP2c, Phosphatidate Phosphohydrolase Type 2c, PAP2-gamma, PAP2-G, LPP2) (FITC)
MBS6492982-02 5x 0.2 mL

PPAP2C, CT (Lipid Phosphate Phosphohydrolase 2, Phosphatidic Acid Phosphatase 2c, PAP-2c, PAP2c, Phosphatidate Phosphohydrolase Type 2c, PAP2-gamma, PAP2-G, LPP2) (FITC)

Sign In for Pricing
View Details
C21orf79 sgRNA CRISPR Lentivector (Human) (Target 3)
K0341604 1.0 µg DNA

C21orf79 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PKG2 Rabbit pAb
E2160929 100 µL

PKG2 Rabbit pAb

Sign In for Pricing
View Details
20 x 10cm Notched Glass Plates with 1mm Bonded Spacers (Pack of 2)
VS10WNGS1 2 PCS/Pack

20 x 10cm Notched Glass Plates with 1mm Bonded Spacers (Pack of 2)

Sign In for Pricing
View Details
STNL P006-150x50-AL-CRD/1 AC Signs
822644 Card of 1 Pictogram(s)

STNL P006-150x50-AL-CRD/1 AC Signs

Sign In for Pricing
View Details