Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD4 Rabbit Polyclonal Antibody (HRP)

JMJD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ12517, MGC129896

UniProt

Q9H9V9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JMJD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRAGPEPQALVGQKRGALRLLVPRLVLTVSAPAEVRRRVLRPVLSWMDRE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_075383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Pancreas
CR561816 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
OTULIN Recombinant Rabbit monoclonal Antibody
HA723891 100 µL

OTULIN Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse VEGF-C (Vascular Endothelial cell Growth Factor C) CLIA Kit
E-CL-M0679-01 24 Tests

Mouse VEGF-C (Vascular Endothelial cell Growth Factor C) CLIA Kit

Sign In for Pricing
View Details
Mouse VEGF-C (Vascular Endothelial cell Growth Factor C) CLIA Kit
E-CL-M0679-02 48 Tests

Mouse VEGF-C (Vascular Endothelial cell Growth Factor C) CLIA Kit

Sign In for Pricing
View Details
Mouse VEGF-C (Vascular Endothelial cell Growth Factor C) CLIA Kit
E-CL-M0679-03 96 Tests

Mouse VEGF-C (Vascular Endothelial cell Growth Factor C) CLIA Kit

Sign In for Pricing
View Details
SLC9A2 (NM_003048) Human Over-expression Lysate
LY401065 100 µg

SLC9A2 (NM_003048) Human Over-expression Lysate

Sign In for Pricing
View Details