Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB4 Rabbit Polyclonal Antibody (Biotin)

HOXB4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX2, HOX2F, HOX-2.6

UniProt

P17483

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXC12 (HOC3F, HOX3, HOX3F, Homeobox C12, Homeo box 3F, Homeo box C12) (MaxLight 490)
207703-ML490 100 µL

HOXC12 (HOC3F, HOX3, HOX3F, Homeobox C12, Homeo box 3F, Homeo box C12) (MaxLight 490)

Sign In for Pricing
View Details
DL-α-Hydroxybehenic acid
sc-214931 10 mg

DL-α-Hydroxybehenic acid

Sign In for Pricing
View Details
Lentiviral mouse Cyb5r4 shRNA (UAS) - Lentiviral mouse Cyb5r4 shRNA (UAS) plasmid
GTR15176275 1 Vial

Lentiviral mouse Cyb5r4 shRNA (UAS) - Lentiviral mouse Cyb5r4 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CD9 Antigen (CD9) Antibody (HRP)
abx341473-01 50 µL

CD9 Antigen (CD9) Antibody (HRP)

Sign In for Pricing
View Details
CD9 Antigen (CD9) Antibody (HRP)
abx341473-02 100 µL

CD9 Antigen (CD9) Antibody (HRP)

Sign In for Pricing
View Details
CD9 Antigen (CD9) Antibody (HRP)
abx341473-03 200 µL

CD9 Antigen (CD9) Antibody (HRP)

Sign In for Pricing
View Details