Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB4 Rabbit Polyclonal Antibody (Biotin)

HOXB4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOX2, HOX2F, HOX-2.6

UniProt

P17483

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076920

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD67 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-1302R-APC-Cy5.5 100 µL

GAD67 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal PDP3 Antibody [DyLight 550]
NBP3-05795R 0.1 mL

Rabbit Polyclonal PDP3 Antibody [DyLight 550]

Sign In for Pricing
View Details
Bryostatin 1 (NSC 339555, B705008K112, BRN 4349157)
MBS653567-01 0.01 mg

Bryostatin 1 (NSC 339555, B705008K112, BRN 4349157)

Sign In for Pricing
View Details
Bryostatin 1 (NSC 339555, B705008K112, BRN 4349157)
MBS653567-02 5x 0.01 mg

Bryostatin 1 (NSC 339555, B705008K112, BRN 4349157)

Sign In for Pricing
View Details
Nemp1 (NM_173732) Mouse Tagged ORF Clone
MR204724 10 µg

Nemp1 (NM_173732) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human SLC9A7 knockout cell line
ABC-KH14209 1 Vial

Human SLC9A7 knockout cell line

Sign In for Pricing
View Details