Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBLL1 Rabbit Polyclonal Antibody (HRP)

CBLL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HAKAI, RNF188

UniProt

Q75N03

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBLL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079090

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 3-bromo-4-methyl-5-nitrobenzoate
YIA51908 5 g

Methyl 3-bromo-4-methyl-5-nitrobenzoate

Sign In for Pricing
View Details
TAOK3 (DPK, JIK, KDS, MAP3K18, Serine/Threonine-protein Kinase TAO3, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, JNK/SAPK-inhibitory Kinase, Jun Kinase-inhibitory Kinase, Kinase from Chicken Homolog A, Tho
MBS649513-01 0.1 mL

TAOK3 (DPK, JIK, KDS, MAP3K18, Serine/Threonine-protein Kinase TAO3, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, JNK/SAPK-inhibitory Kinase, Jun Kinase-inhibitory Kinase, Kinase from Chicken Homolog A, Tho

Sign In for Pricing
View Details
TAOK3 (DPK, JIK, KDS, MAP3K18, Serine/Threonine-protein Kinase TAO3, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, JNK/SAPK-inhibitory Kinase, Jun Kinase-inhibitory Kinase, Kinase from Chicken Homolog A, Tho
MBS649513-02 5x 0.1 mL

TAOK3 (DPK, JIK, KDS, MAP3K18, Serine/Threonine-protein Kinase TAO3, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, JNK/SAPK-inhibitory Kinase, Jun Kinase-inhibitory Kinase, Kinase from Chicken Homolog A, Tho

Sign In for Pricing
View Details
Lentiviral mouse Fhod1 shRNA (UAS) - Lentiviral mouseFhod1 shRNA (UAS, GFP) (25)
GTR15236564 1 Vial

Lentiviral mouse Fhod1 shRNA (UAS) - Lentiviral mouseFhod1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
EcoPlexTM Mouse Th1/Th2 8-Plex Panel Kit
MPM007 96 Tests

EcoPlexTM Mouse Th1/Th2 8-Plex Panel Kit

Sign In for Pricing
View Details
Rocaglamide
ALX-350-121-C100 100 µg

Rocaglamide

Sign In for Pricing
View Details