Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF644 Rabbit Polyclonal Antibody (HRP)

ZNF644 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NatF, MYP21, ZEP-2, BM-005

UniProt

Q9H582

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF644

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVFRG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

149kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_958357

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aconitase 2 (ACO2) (NM_001098) Human Tagged Lenti ORF Clone
RC204307L3 10 µg

Aconitase 2 (ACO2) (NM_001098) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-PHOX2A antibody
PAab06407 100 µg

Anti-PHOX2A antibody

Sign In for Pricing
View Details
YfaD Antibody
orb827930 2 mg

YfaD Antibody

Sign In for Pricing
View Details
Recombinant LLOV GP1 Protein, C-His
VK700011-01 50 µg

Recombinant LLOV GP1 Protein, C-His

Sign In for Pricing
View Details
Recombinant LLOV GP1 Protein, C-His
VK700011-02 100 µg

Recombinant LLOV GP1 Protein, C-His

Sign In for Pricing
View Details
Recombinant LLOV GP1 Protein, C-His
VK700011-03 1 mg

Recombinant LLOV GP1 Protein, C-His

Sign In for Pricing
View Details