Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATOH8 Rabbit Polyclonal Antibody (Biotin)

ATOH8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HATH6, bHLHa21

UniProt

Q96SQ7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATOH8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116216

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxytocin (OT (Sheep ELISA Kit
F6335 96 Tests

Oxytocin (OT (Sheep ELISA Kit

Sign In for Pricing
View Details
Ficolin 2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-13162R-APC-Cy5.5 100 µL

Ficolin 2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
CCDC117 Protein Vector (Mouse) (pPM-C-HA)
PV162080 500 ng

CCDC117 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Steroid sulfatase Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3857R-BF488 100 µL

Steroid sulfatase Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Granzyme K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6788R-BF680-01 20 µL

Granzyme K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Granzyme K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-6788R-BF680-02 100 µL

Granzyme K Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details