Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM41 Rabbit Polyclonal Antibody (HRP)

TRIM41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RINCK

UniProt

Q8WV44

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM41

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_963921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine RPS6Kβ1 (Ribosomal Protein S6 Kinase Beta 1) ValidElisa Kit
EK344578 96 Well

Porcine RPS6Kβ1 (Ribosomal Protein S6 Kinase Beta 1) ValidElisa Kit

Sign In for Pricing
View Details
Mouse DEFβ1 ELISA Kit
E110126 1 Each

Mouse DEFβ1 ELISA Kit

Sign In for Pricing
View Details
Rat Neurl1b Pre-designed siRNA Set B
SI209228B 1 Each

Rat Neurl1b Pre-designed siRNA Set B

Sign In for Pricing
View Details
LASS2 (Ceramide Synthase 2, CerS2, LAG1 Longevity Assurance Homolog 2, SP260, Tumor Metastasis-suppressor Gene 1 Protein, CERS2, TMSG1, FLJ10243, L3, MGC987)
129011 100 µg

LASS2 (Ceramide Synthase 2, CerS2, LAG1 Longevity Assurance Homolog 2, SP260, Tumor Metastasis-suppressor Gene 1 Protein, CERS2, TMSG1, FLJ10243, L3, MGC987)

Sign In for Pricing
View Details
Proto-oncogene Wnt-1, Recombinant, Mouse, aa28-370, His-Tag, Myc-Tag
586064-01 20 µg

Proto-oncogene Wnt-1, Recombinant, Mouse, aa28-370, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Proto-oncogene Wnt-1, Recombinant, Mouse, aa28-370, His-Tag, Myc-Tag
586064-02 100 µg

Proto-oncogene Wnt-1, Recombinant, Mouse, aa28-370, His-Tag, Myc-Tag

Sign In for Pricing
View Details