Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF786 Rabbit Polyclonal Antibody (FITC)

ZNF786 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8N393

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF786

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

EAW80063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rad54l2 shRNA (UAS) - Lentiviral mouse Rad54l2 shRNA (UAS, RFP) plasmid
GTR15291925 1 Vial

Lentiviral mouse Rad54l2 shRNA (UAS) - Lentiviral mouse Rad54l2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant HPV18 L1/Major capsid protein L1 Protein, C-His
MBS1587997-01 0.1 mg

Recombinant HPV18 L1/Major capsid protein L1 Protein, C-His

Sign In for Pricing
View Details
Recombinant HPV18 L1/Major capsid protein L1 Protein, C-His
MBS1587997-02 1 mg

Recombinant HPV18 L1/Major capsid protein L1 Protein, C-His

Sign In for Pricing
View Details
Recombinant HPV18 L1/Major capsid protein L1 Protein, C-His
MBS1587997-03 5x 1 mg

Recombinant HPV18 L1/Major capsid protein L1 Protein, C-His

Sign In for Pricing
View Details
PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: UMAB26]
UM570026 30 µL

PSMA (FOLH1) Mouse Monoclonal Antibody [Clone ID: UMAB26]

Sign In for Pricing
View Details
CD83 Human
OM300631-01 10 µg

CD83 Human

Sign In for Pricing
View Details