Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN29 Rabbit Polyclonal Antibody (Biotin)

ZSCAN29 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF690, Zfp690

UniProt

Q8IWY8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZSCAN29

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSDLRAHHRTHTGEKPYGCHDCGKCFSKSSALNKHGEIHAREKLLTQSAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clathrin, Light Chain (CLC/1421), Biotin conjugate, 0.1mg/mL
BNCB1421-500 1x 500 µL

Clathrin, Light Chain (CLC/1421), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGHD2OR15-2B sgRNA CRISPR Lentivector (Human) (Target 3)
K1028404 1.0 µg DNA

IGHD2OR15-2B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Canine Visceral Adipose Primary Cells
CCEL109 5x 10^5 Cells/Vial

Canine Visceral Adipose Primary Cells

Sign In for Pricing
View Details
MRGPRF Rabbit Polyclonal Antibody
TA340640 50 µg

MRGPRF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Doc2g ORF Vector (Mouse) (pORF)
ORF043260 1.0 µg DNA

Doc2g ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Diclofenac Sodium Salt
TRC-D436450-10G 10 g

Diclofenac Sodium Salt

Sign In for Pricing
View Details