Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLIS3 Rabbit Polyclonal Antibody (HRP)

GLIS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NDH, ZNF515

UniProt

Q8NEA6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GLIS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QASFDVFHRAFSTHSGITVYDLPSSSSSLFGESLRSGAEDATFLQISTVD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

ABE66435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALOX12B Human Over-expression Lysate
orb1364755 20 µg

ALOX12B Human Over-expression Lysate

Sign In for Pricing
View Details
Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit
CK-bio-27714-01 48 Tests

Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit

Sign In for Pricing
View Details
Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit
CK-bio-27714-02 96 Tests

Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit

Sign In for Pricing
View Details
Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit
CK-bio-27714-03 5x 96 Tests

Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit

Sign In for Pricing
View Details
Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit
CK-bio-27714-04 10x 96 Tests

Human soluble HLA class I histocompatibility antigen, alpha chain G (sHLA-G) ELISA Kit

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Glucosamine-6-phosphate deaminase (nagB)
MBS1288899-01 0.02 mg (E-Coli)

Recombinant Vibrio vulnificus Glucosamine-6-phosphate deaminase (nagB)

Sign In for Pricing
View Details