Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU5F1 Rabbit Polyclonal Antibody (HRP)

POU5F1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OCT3, OCT4, OTF3, OTF4, OTF-3, Oct-3, Oct-4

UniProt

Q01860

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POU5F1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQC

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_976034

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD15 HDR Plasmid (m)
sc-426589-HDR 20 µg

ABHD15 HDR Plasmid (m)

Sign In for Pricing
View Details
PE-Cy7 anti-human CD160
E16FHN160-025 25 Tests

PE-Cy7 anti-human CD160

Sign In for Pricing
View Details
Tsc22d4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7505607 1.0 µg DNA

Tsc22d4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Rab3c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
38335114 3x 1.0 µg

Rab3c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
SimplePhase Mouse T4 (Thyroxine) ELISA Kit
EK249354 96 Well

SimplePhase Mouse T4 (Thyroxine) ELISA Kit

Sign In for Pricing
View Details
Anti-GRSF1 antibody
STJ11100184 100 µl

Anti-GRSF1 antibody

Sign In for Pricing
View Details