Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVX2 Rabbit Polyclonal Antibody (HRP)

EVX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVX-2

UniProt

Q03828

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LOC344191

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMERIRKEMILMERGLHSPTAGKRFSNLSNSAGNAVLEALENSQHPARLS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001073927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tdpoz2 (NM_001007222) Mouse Tagged ORF Clone
MR216139 10 µg

Tdpoz2 (NM_001007222) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GFPT2 antibody
70R-8530 100 µL

GFPT2 antibody

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag
056281-01 10 µg

Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag
056281-02 50 µg

Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag
056281-03 100 µg

Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag
056281-04 200 µg

Programmed Cell Death Protein 1 (PD1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details