Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSIG1 Rabbit Polyclonal Antibody (HRP)

INSIG1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CL6

UniProt

A4D2M9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human INSIG1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_938150

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deleted in azoospermia 4 (DAZ4) (NM_020420) Human Mass Spec Standard
PH308193 10 µg

Deleted in azoospermia 4 (DAZ4) (NM_020420) Human Mass Spec Standard

Sign In for Pricing
View Details
RNU7-61P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1860608 1.0 µg DNA

RNU7-61P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DNAJC6, ID (DNAJC6, KIAA0473, Putative tyrosine-protein phosphatase auxilin, DnaJ homolog subfamily C member 6) (FITC)
MBS6292886-01 0.2 mL

DNAJC6, ID (DNAJC6, KIAA0473, Putative tyrosine-protein phosphatase auxilin, DnaJ homolog subfamily C member 6) (FITC)

Sign In for Pricing
View Details
DNAJC6, ID (DNAJC6, KIAA0473, Putative tyrosine-protein phosphatase auxilin, DnaJ homolog subfamily C member 6) (FITC)
MBS6292886-02 5x 0.2 mL

DNAJC6, ID (DNAJC6, KIAA0473, Putative tyrosine-protein phosphatase auxilin, DnaJ homolog subfamily C member 6) (FITC)

Sign In for Pricing
View Details
Nori® Turkey NRG1α ELISA Kit
GR187114 96 Well

Nori® Turkey NRG1α ELISA Kit

Sign In for Pricing
View Details
ELISA Kit FOR Transmembrane protein 45B
E16449m 96 Tests

ELISA Kit FOR Transmembrane protein 45B

Sign In for Pricing
View Details