Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL32 Rabbit Polyclonal Antibody (Biotin)

RPL32 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L32, PP9932

UniProt

P62910

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RPL32

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSD Polyclonal Antibody
E-AB-68296-01 60 µL

CTSD Polyclonal Antibody

Sign In for Pricing
View Details
CTSD Polyclonal Antibody
E-AB-68296-02 120 µL

CTSD Polyclonal Antibody

Sign In for Pricing
View Details
CTSD Polyclonal Antibody
E-AB-68296-03 200 µL

CTSD Polyclonal Antibody

Sign In for Pricing
View Details
HCLS1, CT (HCLS1, HS1, Hematopoietic lineage cell-specific protein, Hematopoietic cell-specific LYN substrate 1, LckBP1, p75) (Biotin)
MBS6305803-01 0.2 mL

HCLS1, CT (HCLS1, HS1, Hematopoietic lineage cell-specific protein, Hematopoietic cell-specific LYN substrate 1, LckBP1, p75) (Biotin)

Sign In for Pricing
View Details
HCLS1, CT (HCLS1, HS1, Hematopoietic lineage cell-specific protein, Hematopoietic cell-specific LYN substrate 1, LckBP1, p75) (Biotin)
MBS6305803-02 5x 0.2 mL

HCLS1, CT (HCLS1, HS1, Hematopoietic lineage cell-specific protein, Hematopoietic cell-specific LYN substrate 1, LckBP1, p75) (Biotin)

Sign In for Pricing
View Details
GPR70 Rabbit Polyclonal Antibody (Cy5.5)
orb1013861 100 µL

GPR70 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details