Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPLP0 Rabbit Polyclonal Antibody (HRP)

RPLP0 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P0, LP0, L10E, RPP0, PRLP0

UniProt

P05388

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPLP0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HIV-1 (group M, subtype A, isolate 92RW020) Envelope glycoprotein gp160 Protein (gp120 subunit) (His Tag)
PKSV030181 100 µg

Recombinant HIV-1 (group M, subtype A, isolate 92RW020) Envelope glycoprotein gp160 Protein (gp120 subunit) (His Tag)

Sign In for Pricing
View Details
2-Hydroxypentanoic Acid
TRC-H250210-500MG 500 mg

2-Hydroxypentanoic Acid

Sign In for Pricing
View Details
SPRYD5 (TRIM51) (NM_032681) Human Over-expression Lysate
LC432250 20 µg

SPRYD5 (TRIM51) (NM_032681) Human Over-expression Lysate

Sign In for Pricing
View Details
Mps1 (TTK) (N-term) Rabbit Polyclonal Antibody
AP15062PU-N 400 µL

Mps1 (TTK) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tm9sf3 Mouse Gene Knockout Kit (CRISPR)
KN517650 1 Kit

Tm9sf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Human CD66e Antibody[A5B7]
AN004750P-01 25 µg

Purified Anti-Human CD66e Antibody[A5B7]

Sign In for Pricing
View Details