Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPLP0 Rabbit Polyclonal Antibody (HRP)

RPLP0 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P0, LP0, L10E, RPP0, PRLP0

UniProt

P05388

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RPLP0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (B22.1), CF594 conjugate, 0.1mg/mL
BNC941219-500 1x 500 µL

Cytokeratin 8 (B22.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM230I (NM_001006606) Human Over-expression Lysate
LY423685 100 µg

FAM230I (NM_001006606) Human Over-expression Lysate

Sign In for Pricing
View Details
EIF2G (EIF2S3) (NM_001415) Human Over-expression Lysate
LC419953 20 µg

EIF2G (EIF2S3) (NM_001415) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin-10 Antibody
KC-477-01 50 μL

Cytokeratin-10 Antibody

Sign In for Pricing
View Details
Cytokeratin-10 Antibody
KC-477-02 100 µL

Cytokeratin-10 Antibody

Sign In for Pricing
View Details
Cytokeratin-10 Antibody
KC-477-03 1 mL

Cytokeratin-10 Antibody

Sign In for Pricing
View Details