Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBMS3 Rabbit Polyclonal Antibody (Biotin)

RBMS3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6XE24

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RBMS3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001003792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSDHL CRISPR/Cas9 KO Plasmid (m)
sc-421971 20 µg

NSDHL CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
NAP1L3, CT (NAP1L3, BNAP, Nucleosome assembly protein 1-like 3)
MBS6001674-01 0.2 mL

NAP1L3, CT (NAP1L3, BNAP, Nucleosome assembly protein 1-like 3)

Sign In for Pricing
View Details
NAP1L3, CT (NAP1L3, BNAP, Nucleosome assembly protein 1-like 3)
MBS6001674-02 5x 0.2 mL

NAP1L3, CT (NAP1L3, BNAP, Nucleosome assembly protein 1-like 3)

Sign In for Pricing
View Details
Cytokeratin 6B Antibody
E51A10901 100 µL

Cytokeratin 6B Antibody

Sign In for Pricing
View Details
GHRF (1-44) Human Peptide
PE-52257-01 1 mg

GHRF (1-44) Human Peptide

Sign In for Pricing
View Details
GHRF (1-44) Human Peptide
PE-52257-02 5 mg

GHRF (1-44) Human Peptide

Sign In for Pricing
View Details