Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUGP2 Rabbit Polyclonal Antibody (HRP)

SUGP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SFRS14, SRFS14

UniProt

Q8IX01

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGPSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQVIGHRKLGHFRSQD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

120 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

NCBI Accession Number

NP_001017392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Matrix Metalloproteinase 3 (MMP-3) Activity Fluorometric Assay Kit
E-BC-F061-01 48 T (30 samples)

Matrix Metalloproteinase 3 (MMP-3) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP-3) Activity Fluorometric Assay Kit
E-BC-F061-02 96 T (78 samples)

Matrix Metalloproteinase 3 (MMP-3) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
PE Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126D-01 20 Tests

PE Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
PE Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126D-02 100 Tests

PE Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
PE Anti-Human CD1a Antibody[OKT-6]
E-AB-F1126D-03 2x 100 Tests

PE Anti-Human CD1a Antibody[OKT-6]

Sign In for Pricing
View Details
C21orf62 (NM_001162496) Human Over-expression Lysate
LY431795 100 µg

C21orf62 (NM_001162496) Human Over-expression Lysate

Sign In for Pricing
View Details