Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

U2AF1L4 Rabbit Polyclonal Antibody (HRP)

U2AF1L4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

U2af26, U2AF1L3, U2AF1RS3, U2AF1-RS3, U2AF1L3V1

UniProt

Q8WU68

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human U2AF1L4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAE1 Blocking Peptide
MBS9627511-01 1 mg

RAE1 Blocking Peptide

Sign In for Pricing
View Details
RAE1 Blocking Peptide
MBS9627511-02 5x 1 mg

RAE1 Blocking Peptide

Sign In for Pricing
View Details
TIPUH1 shRNA (m) Lentiviral Particles
sc-154284-V 200 µL

TIPUH1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
LOXL2 Human Monoclonal Antibody
orb2975368-01 50 µg

LOXL2 Human Monoclonal Antibody

Sign In for Pricing
View Details
LOXL2 Human Monoclonal Antibody
orb2975368-02 100 µg

LOXL2 Human Monoclonal Antibody

Sign In for Pricing
View Details
(Pyr⁶, Pro⁹) -Substance P (6-11)
4007705.0001 1 mg

(Pyr⁶, Pro⁹) -Substance P (6-11)

Sign In for Pricing
View Details