Animal-Free IL-16, Human (His)
Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-16 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html
Smiles
MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
Molecular Formula
3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15314507 1 Vial
Lentiviral human OSGIN2 shRNA (UAS) - Lentiviral human OSGIN2 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
CN-03850H2 48T
Human anti-alpha-Fodrin IgG/IgA,α-Fodrin IgG/IgA ELISA Kit
Sign In for Pricing
View Details MBS9020833-01 0.02 mg (E-Coli)
Recombinant Mycobacterium tuberculosis Amidophosphoribosyltransferase (purF)
Sign In for Pricing
View Details MBS9020833-02 0.02 mg (Yeast)
Recombinant Mycobacterium tuberculosis Amidophosphoribosyltransferase (purF)
Sign In for Pricing
View Details 
MBS9020833-03 0.1 mg (E-Coli)
Recombinant Mycobacterium tuberculosis Amidophosphoribosyltransferase (purF)
Sign In for Pricing
View Details MBS9020833-04 0.1 mg (Yeast)
Recombinant Mycobacterium tuberculosis Amidophosphoribosyltransferase (purF)
Sign In for Pricing
View Details