Animal-Free IL-16, Human (His)
Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-16 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html
Smiles
MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
Molecular Formula
3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx258142-01 96 Tests
Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit
Sign In for Pricing
View Details 
abx258142-02 5x 96 Tests
Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit
Sign In for Pricing
View Details 
abx258142-03 10x 96 Tests
Human Potassium Inwardly Rectifying Channel Subfamily J, Member 10 (KCNJ10) ELISA Kit
Sign In for Pricing
View Details 20181199-3 2 mL
Protein A Separopore® 6B-CL SupeAmbiantrap™ CaAmbiantridge
Sign In for Pricing
View Details MBS7226679-01 48 Well
Rabbit Mediator of RNA polymerase II transcription subunit 7 (MED7) ELISA Kit
Sign In for Pricing
View Details