Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPRIN1 3'UTR GFP Stable Cell Line
TU053465 1.0 mL

CAPRIN1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human COX11 Recombinant Protein
PPT-12000 100 µg

Human COX11 Recombinant Protein

Sign In for Pricing
View Details
XRCC3 3'UTR GFP Stable Cell Line
TU078613 1.0 mL

XRCC3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Ataxin-2-like protein (ATXN2L) ELISA Kit
MBS7247331-01 48 Well

Mouse Ataxin-2-like protein (ATXN2L) ELISA Kit

Sign In for Pricing
View Details
Mouse Ataxin-2-like protein (ATXN2L) ELISA Kit
MBS7247331-02 96 Well

Mouse Ataxin-2-like protein (ATXN2L) ELISA Kit

Sign In for Pricing
View Details
Mouse Ataxin-2-like protein (ATXN2L) ELISA Kit
MBS7247331-03 5x 96 Well

Mouse Ataxin-2-like protein (ATXN2L) ELISA Kit

Sign In for Pricing
View Details