Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal V5 Epitope Tag Antibody (SV5-Pk5) [DyLight 550]
NBP1-80562R 0.1 mL

Mouse Monoclonal V5 Epitope Tag Antibody (SV5-Pk5) [DyLight 550]

Sign In for Pricing
View Details
RNF113B (RING Finger Protein 113B)
490637 100 µL

RNF113B (RING Finger Protein 113B)

Sign In for Pricing
View Details
PION Protein Vector (Rat) (pPM-C-His)
PV294125 500 ng

PION Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
CFP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV791315 1.0 µg DNA

CFP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
DLK2 ORF Vector (Human) (pORF)
ORF003145 1.0 µg DNA

DLK2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Bone Marrow Stromal Cell Antigen 1 (BST1) Antibody Pair Kit (with Standard)
MBS2100550-01 5x 96 Tests

Mouse Bone Marrow Stromal Cell Antigen 1 (BST1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details