Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid
229659-01 100 mg

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid

Sign In for Pricing
View Details
2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid
229659-02 250 mg

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid

Sign In for Pricing
View Details
2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid
229659-03 1 g

2-Acetamido-2- (1- (Tert-Butoxycarbonyl) Piperidin-4-Yl) Propanoic Acid

Sign In for Pricing
View Details
Zbtb3 (NM_001109162) Rat Tagged ORF Clone Lentiviral Particle
RR214680L3V 200 µL

Zbtb3 (NM_001109162) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD21 Mouse Monoclonal Antibody
TD-M50773 100 µL

CD21 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Magic™ Mouse Anti-NIV gF Monoclonal antibody, clone54DL5
CABT-RM238 1 mg

Magic™ Mouse Anti-NIV gF Monoclonal antibody, clone54DL5

Sign In for Pricing
View Details