Animal-Free IL-16, Human (His)
Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.
Product Specifications
Product Name Alternative
Animal-Free IL-16 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html
Smiles
MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS
Molecular Formula
3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
33376-05161 5x 30 µg
Human UBTD2 AssayLite™ Antibody (APC Conjugate)
Sign In for Pricing
View Details 
LV754712 1.0 µg DNA
TSPY21P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details RC214939L1V 200 µL
C21orf34 (NM_001005732) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details