Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF27 shRNA Plasmid (m)
sc-146474-SH 20 µg

KIF27 shRNA Plasmid (m)

Sign In for Pricing
View Details
NUP43 (NM_198887) Human Tagged Lenti ORF Clone
RC209014L3 10 µg

NUP43 (NM_198887) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RSPH14 Antibody (FITC)
abx311922-01 20 µg

RSPH14 Antibody (FITC)

Sign In for Pricing
View Details
RSPH14 Antibody (FITC)
abx311922-02 50 µg

RSPH14 Antibody (FITC)

Sign In for Pricing
View Details
RSPH14 Antibody (FITC)
abx311922-03 100 µg

RSPH14 Antibody (FITC)

Sign In for Pricing
View Details
RSPH14 Antibody (FITC)
abx311922-04 200 µg

RSPH14 Antibody (FITC)

Sign In for Pricing
View Details