Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DDR2 Antibody (1R524)
MF-0072669-01 20 µL

Anti-DDR2 Antibody (1R524)

Sign In for Pricing
View Details
Anti-DDR2 Antibody (1R524)
MF-0072669-02 100 µL

Anti-DDR2 Antibody (1R524)

Sign In for Pricing
View Details
SEPT1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7769R-BF488 100 µL

SEPT1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Mmp13 shRNA (UAS) - Lentiviral mouse Mmp13 shRNA (UAS, iRFP) (25)
GTR15287714 1 Vial

Lentiviral mouse Mmp13 shRNA (UAS) - Lentiviral mouse Mmp13 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human OR8K5 activation kit by CRISPRa
GA116487 1 Kit

Human OR8K5 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Monoclonal ATP Citrate Lyase Antibody (OTI3G8) [Alexa Fluor 700]
NBP2-70073AF700 0.1 mL

Mouse Monoclonal ATP Citrate Lyase Antibody (OTI3G8) [Alexa Fluor 700]

Sign In for Pricing
View Details