Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF485 Recombinant Protein Antigen
NBP2-32451PEP 0.1 mL

ZNF485 Recombinant Protein Antigen

Sign In for Pricing
View Details
Lawsonia intracellularis RT PCR kit
RTq-V119-150D 150T

Lawsonia intracellularis RT PCR kit

Sign In for Pricing
View Details
BIOTIN*Rabbit Anti Human IgM (u chain)
SA0283 100 µL

BIOTIN*Rabbit Anti Human IgM (u chain)

Sign In for Pricing
View Details
Lentiviral mouse Majin shRNA (UAS) - Lentiviral mouse Majin shRNA (UAS) (25)
GTR15222893 1 Vial

Lentiviral mouse Majin shRNA (UAS) - Lentiviral mouse Majin shRNA (UAS) (25)

Sign In for Pricing
View Details
CD48 (HRP) discontinued
C2403-09B-HRP 100 µL

CD48 (HRP) discontinued

Sign In for Pricing
View Details
TRIM28-set siRNA/shRNA/RNAi Lentivector (Human)
47762091 4x 500 ng

TRIM28-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details