Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad52 Recombinant Protein (Mouse)
RP166517 100 µg

Rad52 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Kb21 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV634534 1.0 µg DNA

Kb21 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Ppp2r3a ORF Vector (Mouse) (pORF)
ORF054673 1.0 µg DNA

Ppp2r3a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Interleukin 8 / IL8 (CXCL8) Antibody
abx131840-01 100 µL

Interleukin 8 / IL8 (CXCL8) Antibody

Sign In for Pricing
View Details
Interleukin 8 / IL8 (CXCL8) Antibody
abx131840-02 200 µL

Interleukin 8 / IL8 (CXCL8) Antibody

Sign In for Pricing
View Details
Interleukin 8 / IL8 (CXCL8) Antibody
abx131840-03 1 mL

Interleukin 8 / IL8 (CXCL8) Antibody

Sign In for Pricing
View Details