Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATC1 Antibody
MBS9522729-01 0.04 mL

SPATC1 Antibody

Sign In for Pricing
View Details
SPATC1 Antibody
MBS9522729-02 0.1 mL

SPATC1 Antibody

Sign In for Pricing
View Details
SPATC1 Antibody
MBS9522729-03 0.2 mL

SPATC1 Antibody

Sign In for Pricing
View Details
SPATC1 Antibody
MBS9522729-04 5x 0.2 mL

SPATC1 Antibody

Sign In for Pricing
View Details
Recombinant Human APP Protein, N-His
YHC12502 100 μg

Recombinant Human APP Protein, N-His

Sign In for Pricing
View Details
Lentiviral human PGLYRP1 shRNA (UAS) - Lentiviral human PGLYRP1 shRNA (UAS, GFP) (25)
GTR15080840 1 Vial

Lentiviral human PGLYRP1 shRNA (UAS) - Lentiviral human PGLYRP1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details