Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMEL Protein Vector (Human) (pPB-N-His)
PV111963 500 ng

PMEL Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mrpl35 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4472102 1.0 µg DNA

Mrpl35 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
BCMO1, ID (BCMO1, BCDO, BCDO1, Beta, beta-carotene 15,15'-monooxygenase, Beta-carotene dioxygenase 1) (MaxLight 550) discontinued
032476-ML550 100 µL

BCMO1, ID (BCMO1, BCDO, BCDO1, Beta, beta-carotene 15,15'-monooxygenase, Beta-carotene dioxygenase 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PCDHA2 Antibody (N-term) Blocking Peptide
MBS9223247-01 0.5 mg

PCDHA2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
PCDHA2 Antibody (N-term) Blocking Peptide
MBS9223247-02 5x 0.5 mg

PCDHA2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
Anti-Met (c-Met) Rabbit Monoclonal Antibody
MBS179672-01 0.03 mL

Anti-Met (c-Met) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details