Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP3 (NM_001001330) Human Over-expression Lysate
LY400360 100 µg

REEP3 (NM_001001330) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Or1q1 qPCR Primer Pair
QM66430S 200 Tests

Mouse Or1q1 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Anti-MICA antibody
SL0832R-01 50 µL

Rabbit Anti-MICA antibody

Sign In for Pricing
View Details
Rabbit Anti-MICA antibody
SL0832R-02 100 µL

Rabbit Anti-MICA antibody

Sign In for Pricing
View Details
Cp ORF Vector (Mouse) (pORF)
ORF041896 1.0 µg DNA

Cp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Smpd1 Rat Pre-designed siRNA Set A
HY-RS24465 1 Set

Smpd1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details