Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-409a-5p Primers
MPR00680 150 µL / 10 µM

rno-miR-409a-5p Primers

Sign In for Pricing
View Details
MRPS22 (NM_020191) Human Mass Spec Standard
PH303424 10 µg

MRPS22 (NM_020191) Human Mass Spec Standard

Sign In for Pricing
View Details
Anti-Phospho-Tau (pT212/pS214) Antibody
MBS1569080-01 0.1 mg

Anti-Phospho-Tau (pT212/pS214) Antibody

Sign In for Pricing
View Details
Anti-Phospho-Tau (pT212/pS214) Antibody
MBS1569080-02 1 mg

Anti-Phospho-Tau (pT212/pS214) Antibody

Sign In for Pricing
View Details
Anti-Phospho-Tau (pT212/pS214) Antibody
MBS1569080-03 5x 1 mg

Anti-Phospho-Tau (pT212/pS214) Antibody

Sign In for Pricing
View Details
PEnCMV-MYH9 (human) (1-77aa) -3xHA-SV40-Neo
BZ43425 1 Vial

PEnCMV-MYH9 (human) (1-77aa) -3xHA-SV40-Neo

Sign In for Pricing
View Details