Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-16, Human (His)

Animal-Free IL-16 Protein, Human (His) is the recombinant human-derived animal-FreeIL-16 protein, expressed by E. coli, with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-16-protein-human-his.html

Smiles

MPDLNSSTDSAASASAASDVSVESTEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS

Molecular Formula

3603 (Gene_ID) XP_047288413.1 (M593-S721) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC37 3'UTR Luciferase Stable Cell Line
TU003611 1.0 mL

CCDC37 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Baohuoside II discontinued
371212 5 mg

Baohuoside II discontinued

Sign In for Pricing
View Details
GAB2 Antibody
MBS9600048-01 0.1 mL

GAB2 Antibody

Sign In for Pricing
View Details
GAB2 Antibody
MBS9600048-02 0.2 mL

GAB2 Antibody

Sign In for Pricing
View Details
GAB2 Antibody
MBS9600048-03 5x 0.2 mL

GAB2 Antibody

Sign In for Pricing
View Details
Dacomitinib Impurity 57
RM-D012257-01 10 mg

Dacomitinib Impurity 57

Sign In for Pricing
View Details