Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oas1g Rabbit Polyclonal Antibody (FITC)

Oas1g Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, O, L2, Oi, Mmu-, Mmu-L, Oas1b, Oias1, Mmu-L2, Oias-1, AI449562

UniProt

Q8K469

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKGGSSGKGTTLKGRSDADLVVFLNNLTSFEDQLNRRGEFIKEIKKQLYE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tspan31 Mouse Gene Knockout Kit (CRISPR)
KN518357 1 Kit

Tspan31 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody [Clone ID: L17F12]
AM26700RP-N 100 Tests

CD5 Mouse Monoclonal Antibody [Clone ID: L17F12]

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS629903 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
YBEY (NM_001006114) Human Over-expression Lysate
LY423677 100 µg

YBEY (NM_001006114) Human Over-expression Lysate

Sign In for Pricing
View Details
MYL3 antibody
FNab09860 100 µg

MYL3 antibody

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3244), CF640R conjugate, 0.1mg/mL
BNC403244-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3244), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details