Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA6 Rabbit Polyclonal Antibody (HRP)

PSMA6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IOTA, p27K, PROS27

UniProt

P60900

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PSMA6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001269161.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PDIA6 Antibody Picoband® (monoclonal, 3H5E7) Fluoro550 Conjugated
M03813-1-Fluoro550 100 µg/Vial

Anti-PDIA6 Antibody Picoband® (monoclonal, 3H5E7) Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Ube2n shRNA (UAS) - Lentiviral mouse Ube2n shRNA (UAS, RFP) plasmid
GTR15266077 1 Vial

Lentiviral mouse Ube2n shRNA (UAS) - Lentiviral mouse Ube2n shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TSTD1 (NM_001113205) Human Tagged Lenti ORF Clone
RC225033L3 10 µg

TSTD1 (NM_001113205) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal TRPM7 Antibody (S74-25) [DyLight 755]
NBP2-12906IR 0.1 mL

Mouse Monoclonal TRPM7 Antibody (S74-25) [DyLight 755]

Sign In for Pricing
View Details
LINS Protein Vector (Mouse) (pPM-C-HA)
26867024 500 ng

LINS Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MMP19 Protein Vector (Mouse) (pPM-C-HA)
30240024 500 ng

MMP19 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details