Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PABPC4 Rabbit Polyclonal Antibody (HRP)

PABPC4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APP1, APP-1, PABP4, iPABP

UniProt

Q13310

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PABPC4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003810

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Daunorubicin-13C, d3
MD34963 0.25 mg

Daunorubicin-13C, d3

Sign In for Pricing
View Details
Lentiviral mouse Lemd3 shRNA (UAS) - Lentiviral mouse Lemd3 shRNA (UAS, iRFP) plasmid
GTR15248332 1 Vial

Lentiviral mouse Lemd3 shRNA (UAS) - Lentiviral mouse Lemd3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
SPPL2B (Signal peptide Peptidase-like 2B, SPP-like 2B, SPPL2b, 3423-, Intramembrane Protease 4, IMP-4, Presenilin Homologous Protein 4, PSH4, Presenilin-like Protein 1, SPPL2B, IMP4, KIAA1532, PSL1) (MaxLight 750)
MBS6459482-01 0.1 mL

SPPL2B (Signal peptide Peptidase-like 2B, SPP-like 2B, SPPL2b, 3423-, Intramembrane Protease 4, IMP-4, Presenilin Homologous Protein 4, PSH4, Presenilin-like Protein 1, SPPL2B, IMP4, KIAA1532, PSL1) (MaxLight 750)

Sign In for Pricing
View Details
SPPL2B (Signal peptide Peptidase-like 2B, SPP-like 2B, SPPL2b, 3423-, Intramembrane Protease 4, IMP-4, Presenilin Homologous Protein 4, PSH4, Presenilin-like Protein 1, SPPL2B, IMP4, KIAA1532, PSL1) (MaxLight 750)
MBS6459482-02 5x 0.1 mL

SPPL2B (Signal peptide Peptidase-like 2B, SPP-like 2B, SPPL2b, 3423-, Intramembrane Protease 4, IMP-4, Presenilin Homologous Protein 4, PSH4, Presenilin-like Protein 1, SPPL2B, IMP4, KIAA1532, PSL1) (MaxLight 750)

Sign In for Pricing
View Details
Anti-Mouse CD37 Antibody (252-3#), APC
MY564137-01 1 Each

Anti-Mouse CD37 Antibody (252-3#), APC

Sign In for Pricing
View Details
Anti-Mouse CD37 Antibody (252-3#), APC
MY564137-02 100 Tests

Anti-Mouse CD37 Antibody (252-3#), APC

Sign In for Pricing
View Details