Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF3 Rabbit Polyclonal Antibody (FITC)

ILF3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CBTF, DRBF, MMP4, MPP4, NF90, NFAR, NF110, NF90a, NF90b, NF90c, NFAR2, TCP80, DRBP76, NF110b, NFAR-1, NFAR-2, NFAR90, TCP110, MPP4110, NF90ctv, NFAR110, MPHOSPH4, NF-AT-90

UniProt

Q12906

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ILF3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004507

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1484 3'UTR GFP Stable Cell Line
TU164960 1.0 mL

Olfr1484 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ltb 3'UTR Luciferase Stable Cell Line
TU212648 1.0 mL

Ltb 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
IGF1 Protein Vector (Rat) (pPM-C-HA)
PV274148 500 ng

IGF1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Kansl2 shRNA (UAS) - Lentiviral mouse Kansl2 shRNA (UAS) plasmid
GTR15278899 1 Vial

Lentiviral mouse Kansl2 shRNA (UAS) - Lentiviral mouse Kansl2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Epstein-Barr virus Induced Protein 3 (EBI3) Mouse ELISA Kit
D2293 96 Tests

Epstein-Barr virus Induced Protein 3 (EBI3) Mouse ELISA Kit

Sign In for Pricing
View Details
N, N-Dibenzyl-3-azabicyclo[3.1.0]hexan-6-amine
VIA15868-01 100 mg

N, N-Dibenzyl-3-azabicyclo[3.1.0]hexan-6-amine

Sign In for Pricing
View Details